"message" : "2145879", .attr('aria-expanded','false'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "linkDisabled" : "false" "context" : "lia-deleted-state", return false; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2145879 .lia-rating-control-passive', '#form_1'); { { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ { "actions" : [ { { } { "event" : "addMessageUserEmailSubscription", } "initiatorBinding" : true, }, ] "context" : "envParam:quiltName,product,contextId,contextUrl", ], "context" : "envParam:quiltName,message,product,contextId,contextUrl", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); { "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_4e248f63f904fa', 'disableAutoComplete', '#ajaxfeedback_4e248f6223281a_0', 'LITHIUM:ajaxError', {}, '4Pxch-QBkOltWEeKuafXkkZr5JMevuOTI4c0hoAhAWk. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ } if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); watching = false; } "parameters" : { "event" : "MessagesWidgetMessageEdit", { }, { "action" : "rerender" ] LITHIUM.AjaxSupport.ComponentEvents.set({ watching = false; "action" : "rerender" } "context" : "", "context" : "envParam:entity", "dialogContentCssClass" : "lia-panel-dialog-content", { { "actions" : [ "action" : "rerender" } { } { { { "event" : "unapproveMessage", "context" : "lia-deleted-state", "actions" : [ "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ "context" : "envParam:entity", if (val.trim() == "") { "actions" : [ "context" : "", "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, { }, "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] ] "useSubjectIcons" : "true", "actions" : [ } ] }, "truncateBodyRetainsHtml" : "false", }, "disallowZeroCount" : "false", { Kein Empfang von VOX HD, RTL HD, RTL2 HD n-TV-HD über HD+, aber Empfang von Pro7 HD und die ÖR Ahnungslos99 am 24.01.2021 – Letzte Antwort am 25.01.2021 – 12 Beiträge : Kein RTL HD trotz HD+ D3nNy am 21.03.2012 – Letzte Antwort am 26.03.2012 – 6 Beiträge : schlechter Empfang von … "componentId" : "forums.widget.message-view", }, }, { }, }, { "context" : "", element.siblings('li').find('ul').slideUp(); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { { { { ] var expireDate = new Date(); "action" : "rerender" LITHIUM.Dialog.options['1720224558'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { watching = false; { "useCountToKudo" : "false", "event" : "MessagesWidgetCommentForm", Execute whatever should happen when entering the right sequence "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { .attr('aria-expanded','false') } }); { } }, "includeRepliesModerationState" : "false", }, "event" : "MessagesWidgetEditAction", { "context" : "", "actions" : [ "context" : "", element.find('ul').slideUp(); ], { }, }, { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "actions" : [ "event" : "ProductAnswerComment", { "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "context" : "envParam:entity", "actions" : [ "truncateBody" : "true", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); }, ] "actions" : [ "action" : "rerender" "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", "useSimpleView" : "false", "truncateBody" : "true", "actions" : [ } { "event" : "approveMessage", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2146396 .lia-rating-control-passive', '#form_4'); "actions" : [ return false; ] "context" : "", "entity" : "2145770", }); LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "displaySubject" : "true", { { "context" : "envParam:feedbackData", "context" : "envParam:feedbackData", "context" : "", "kudosable" : "true", }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2146396,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:feedbackData", "truncateBody" : "true", ] count = 0; }); { }, })(LITHIUM.jQuery); "action" : "rerender" } "event" : "addThreadUserEmailSubscription", "actions" : [ "event" : "MessagesWidgetCommentForm", { "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "selector" : "#messageview", "context" : "envParam:quiltName", "actions" : [ "event" : "MessagesWidgetCommentForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", ] "actions" : [ }, "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "selector" : "#kudosButtonV2_6", "event" : "expandMessage", "actions" : [ { } "actions" : [ { } { "actions" : [ "event" : "removeMessageUserEmailSubscription", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "RevokeSolutionAction", "context" : "", } } "context" : "envParam:quiltName", { "kudosLinksDisabled" : "false", } "context" : "lia-deleted-state", "context" : "envParam:feedbackData", "context" : "", "event" : "RevokeSolutionAction", { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] { "context" : "", { $(event.data.selector).addClass('cssmenu-open') "displayStyle" : "horizontal", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", { } "action" : "pulsate" { "actions" : [ }, { if ( Number(val) > 3 ) ] "event" : "RevokeSolutionAction", "action" : "rerender" { { "useSubjectIcons" : "true", $(document).ready(function(){ "event" : "MessagesWidgetAnswerForm", "context" : "", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/168240","ajaxErrorEventName":"LITHIUM:ajaxError","token":"KOf-pD_GKLpofBE8xWHV6XA7F4caQmwn25qDiblMyD0. "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "action" : "rerender" } }); "action" : "rerender" "event" : "approveMessage", { "action" : "rerender" { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); { { }, "action" : "rerender" "event" : "approveMessage", "actions" : [ }, } "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/168240","ajaxErrorEventName":"LITHIUM:ajaxError","token":"n1RnKR5X2rY88MfzKlu9BAXhKGXTgzTS_KQH0PoDaqw. } ] ] { "action" : "rerender" ] ] ] { ] } } "message" : "2147131", "actions" : [ { "action" : "rerender" } { }, "action" : "rerender" { "selector" : "#messageview_3", "context" : "", } }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, ] "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", ] "context" : "envParam:quiltName,message", "disableKudosForAnonUser" : "false", "actions" : [ "context" : "", "event" : "addThreadUserEmailSubscription", { "context" : "", "action" : "pulsate" } else { "event" : "kudoEntity", "event" : "ProductAnswer", }, }, { { { }, { } { "actions" : [ // We made it! "entity" : "2146937", }, { "event" : "unapproveMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { { "action" : "rerender" }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/168240","ajaxErrorEventName":"LITHIUM:ajaxError","token":"c_3g9pRr_mKJbm_q7f_II84LDHH2QfBw3BUqLMwv2Ek. { "selector" : "#kudosButtonV2_6", "event" : "kudoEntity", "action" : "rerender" { "event" : "QuickReply", "action" : "rerender" }, } "event" : "MessagesWidgetAnswerForm", }, "action" : "rerender" ] "context" : "", }, } } "event" : "deleteMessage", { "actions" : [ "kudosLinksDisabled" : "false", { { $(document).ready(function(){ "actions" : [ ] { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", ] }, "showCountOnly" : "false", setCookie: function(cookieName, cookieValue) { { "action" : "pulsate" { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "unapproveMessage", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "actions" : [ "message" : "2147131", { "linkDisabled" : "false" "displayStyle" : "horizontal", } { "event" : "ProductAnswer", "event" : "removeThreadUserEmailSubscription", ] "context" : "", }, "componentId" : "forums.widget.message-view", "event" : "deleteMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'TzV7YcOyxCapJDmQI4vIdCItKRMu--OJTrenZxPIWP4. { "actions" : [ { }); "event" : "editProductMessage", }, "actions" : [ }, "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditAction", { "defaultAriaLabel" : "", } ;(function($) { // --> } "event" : "kudoEntity", "action" : "rerender" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); } "initiatorDataMatcher" : "data-lia-message-uid" }, { Der Kanal Sport 1 HD funktioniert aber ? } "context" : "", { { }, ] "actions" : [ "context" : "", }, } ] "action" : "rerender" ] "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", "context" : "envParam:quiltName,expandedQuiltName", }, '; }, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "actions" : [ "event" : "unapproveMessage", "action" : "rerender" { { "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } { "action" : "rerender" "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" }, }, }); { } ] "componentId" : "kudos.widget.button", ] "actions" : [ } if ( count == neededkeys.length ) { "actions" : [ "actions" : [ "truncateBodyRetainsHtml" : "false", ], "context" : "envParam:entity", }, "truncateBody" : "true", { "dialogKey" : "dialogKey" } "context" : "envParam:quiltName", "eventActions" : [ "parameters" : { ], "context" : "", "event" : "deleteMessage", "actions" : [ "truncateBody" : "true", "action" : "rerender" { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }, "event" : "MessagesWidgetEditCommentForm", lithadmin: [] "message" : "2146396", "disableLabelLinks" : "false", "context" : "", "event" : "ProductMessageEdit", { "event" : "MessagesWidgetMessageEdit", "includeRepliesModerationState" : "false", { }, { "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233829}); "action" : "rerender" "actions" : [ "context" : "", "action" : "rerender" "action" : "pulsate" "actions" : [ { Im EPG werden die Programme angezeigt ich kann diese dort auswählen, es erscheint aber dann die o.g Meldung. ], "event" : "AcceptSolutionAction", "disallowZeroCount" : "false", "context" : "", ] "parameters" : { } } { "componentId" : "forums.widget.message-view", { "includeRepliesModerationState" : "false", "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); } "disableKudosForAnonUser" : "false", { "truncateBody" : "true", "event" : "kudoEntity", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2147333,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "actions" : [ } "context" : "", } if ( Number(val) < 1 ) "disableLinks" : "false", { "closeEvent" : "LITHIUM:lightboxCloseEvent", { "componentId" : "kudos.widget.button", ] "action" : "rerender" ] "}); ] "action" : "rerender" "action" : "pulsate" watching = false; "context" : "", "quiltName" : "ForumMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "parameters" : { } LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "truncateBody" : "true", count = 0; } "useTruncatedSubject" : "true", { "useCountToKudo" : "false", "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Dialog.options['448333686'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { ;(function($) { ] }, } } "actions" : [ "disableLinks" : "false", "action" : "pulsate" "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } "action" : "rerender" }, "context" : "", }, "context" : "envParam:quiltName,product,contextId,contextUrl", o.innerHTML = "Page must be an integer number. "event" : "MessagesWidgetCommentForm", }, ] { "action" : "rerender" { count = 0; ] { }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); "event" : "ProductAnswer", { "event" : "MessagesWidgetEditCommentForm", }, "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "pulsate" { "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditAction", var count = 0; LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "event" : "AcceptSolutionAction", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] Durch eine technische Störung im Netz ist zurzeit ein eingeschränkter TV-Empfang über T-Home möglich. "action" : "rerender" "actions" : [ "actions" : [ "action" : "rerender" }, "event" : "QuickReply", } "actions" : [ ] { } } "action" : "rerender" }, } }); { { "event" : "editProductMessage", } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2147469,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "selector" : "#kudosButtonV2_5", { ] { "linkDisabled" : "false" "showCountOnly" : "false", { }, "context" : "envParam:feedbackData", }, "context" : "lia-deleted-state", } "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "", // Oops, not the right sequence, lets restart from the top. "event" : "QuickReply", "actions" : [ "action" : "addClassName" "action" : "rerender" "quiltName" : "ForumMessage", } }, LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "initiatorBinding" : true, "action" : "pulsate" "actions" : [ "actions" : [ ', 'ajax'); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } "message" : "2145879", "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); ', 'ajax'); // console.log(key); "actions" : [ "parameters" : { "actions" : [ { "event" : "AcceptSolutionAction", }, $(document).ready(function(){ "context" : "", { "action" : "rerender" { "disableKudosForAnonUser" : "false", } { }, "action" : "pulsate" { ] "context" : "", ] { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, { { }, ], if ( key == neededkeys[0] ) { } ] } { ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2146937 .lia-rating-control-passive', '#form_5'); { } { "action" : "rerender" } { LITHIUM.AjaxSupport.ComponentEvents.set({ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ ] "useSubjectIcons" : "true", if ( neededkeys[count] == key ) { { ] "context" : "envParam:entity", } { "action" : "rerender" ] count = 0; } { "actions" : [ { "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ "displayStyle" : "horizontal", }, "disallowZeroCount" : "false", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "ProductAnswerComment", { "event" : "MessagesWidgetCommentForm", setWarning(pagerId); { "action" : "rerender" "context" : "", "event" : "expandMessage", } ], }, "includeRepliesModerationState" : "false", "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); } { { "disableLabelLinks" : "false",

Ort Mit Boden Rohstoff Kreuzworträtsel 7 Buchstaben, Mailänder Dom Breite, Apple Configurator Windows Alternative, Hsv Hintergrundbild Für Handy, Stadt Northeim Stellenangebote, Pants Für Starke Inkontinenz, Schule Für Kranke Köln Holweide, Carport An Hauswand Befestigen, Retten Im Präteritum, Bürgerserviceportal Bayern Gehaltsabrechnung, Avatar Netflix Remake Release Date,